-
HPA029906-100UL
Anti-PLEC antibody produced in rabbit (C15-1452-461)
Price: $879.43List Price: $977.14Plec (plectin) is an important cytolinker. It is located on human chromosome 8q24. -
HPA031838-100UL
Anti-PLEK antibody produced in rabbit (C15-1453-298)
Price: $889.20List Price: $988.00Immunogen pleckstrin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA057341-100UL
Anti-PLEK antibody produced in rabbit (C15-1462-633)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to pleckstrin Sequence AFLEERDAWVRDINKAIKCIEGGQKFARKSTRRSIRLPETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNC Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
HPA001208-100UL
Anti-PLEK2 antibody produced in rabbit
Price: $879.43List Price: $977.14PLEK2 (Pleckstrin-2) contains a pleckstrin homology (PH) domain and a DEP (Dishevelled, Egl-10, and pleckstrin) domain. It is abundantly expressed in thymus, large bowel, small bowel, stomach, and prostate. -
HPA004706-100UL
Anti-PLEKHA2 antibody produced in rabbit
Price: $879.43List Price: $977.14PLEKHA2 (pleckstrin homology domain containing, family A, phosphoinositide binding specific member 2) is a signal transduction adaptor protein. It is expressed in wide range of tissues including lymphoid tissues. -
HPA028152-100UL
Anti-PLEKHA6 antibody produced in rabbit (C15-1451-726)
Price: $879.43List Price: $977.14Immunogen pleckstrin homology domain containing, family A member 6 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA028157-100UL
ANTI-PLEKHA6 ANTIBODY PRODUCED IN RABBIT (C15-1451-729)
Price: $977.14List Price: $1,085.71Immunogen pleckstrin homology domain containing A6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA054311-100UL
Anti-PLEKHA6 antibody produced in rabbit (C15-1461-637)
Price: $928.29List Price: $1,031.43Immunogen pleckstrin homology domain containing, family A member 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA038610-100UL
Anti-PLEKHA7 antibody produced in rabbit (C15-1455-347)
Price: $977.14List Price: $1,085.71Pleckstrin homology domain containing A7 (PLEKHA7) is a junctional protein, encoded by the gene mapped to human chromosome 11. PLEKHA7 belongs to the group of zonula adherens (ZA) proteins. -
HPA066103-100UL
Anti-PLEKHA7 antibody produced in rabbit (C15-1465-022)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to pleckstrin homology domain containing A7 Sequence ALKENKDQLESVLEVLHRQMEQYRDQPQHLEKIAYQQKLLQEDLVHIRAELSRESTEMENAWNEYLKLENDVEQLKQTLQEQHRRAFFFQEKSQIQKDLWRIEDVTA Application All Prestige Antibodies Powered -
HPA072314-100UL
Anti-PLEKHA8 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA049570-100UL
Anti-PLEKHG5 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen pleckstrin homology domain containing, family G (with RhoGef domain) member 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human