-
HPA077050-100UL
ANTI-PLIN5 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen perilipin 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA051638-100UL
Anti-PLK1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen polo-like kinase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA017327-100UL
Anti-PLK4 antibody produced in rabbit (C15-1448-739)
Price: $879.43List Price: $977.14Immunogen polo-like kinase 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA035026-100UL
Anti-PLK4 antibody produced in rabbit (C15-1453-649)
Price: $928.29List Price: $1,031.43Immunogen polo-like kinase 4 (Drosophila) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA043198-100UL
Anti-PLK4 antibody produced in rabbit (C15-1457-567)
Price: $977.14List Price: $1,085.71Immunogen Recombinant protein corresponding to polo like kinase 4 Sequence CLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFSNPTP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA035024-100UL
Anti-PLK5 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen polo-like kinase 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA041862-100UL
Anti-PLLP antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen plasmolipin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA049137-100UL
Anti-PLOD1 antibody produced in rabbit (C15-1459-838)
Price: $928.29List Price: $1,031.43Immunogen procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA055799-100UL
Anti-PLOD1 antibody produced in rabbit (C15-1462-131)
Price: $928.29List Price: $1,031.43Immunogen procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA001236-100UL
Anti-PLOD3 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA047815-100UL
Anti-PLPP1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen phospholipid phosphatase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA055540-100UL
Anti-PLPP2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen phospholipid phosphatase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the