Rabbit epithelium allergenic extract

Immunogen Protein kinase-like protein SgK196 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Serum paraoxonase/arylesterase 1 recombinant protein epitope signature tag (PrEST) Application Anti-PON1 antibody produced in rabbit is suitable for global protein profiling to find new molecular biomarkers for common, multifactorial

PON3 (paraoxonase 3) belongs to the PON family of enzymes, which consists of three members. This gene is located on human chromosome 7q21-22.

Immunogen Periostin precursor recombinant protein epitope signature tag (PrEST) Application Anti-POSTN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested

Immunogen protection of telomeres 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

POTE ankyrin domain family, member E (POTEE), also called prostate, ovary, testis-expressed protein belongs to POTE family. It is expressed in placenta, ovary, testis and prostate.

Immunogen POU class 1 homeobox 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen POU class 1 homeobox 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen POU class 3 homeobox 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen POU class 3 homeobox 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Synthetic peptide directed towards the C terminal region of human POU3F4 Sequence Synthetic peptide located within the following region: ADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSHTVKTDTSCHDL Physical form Purified antibody supplied in 1x PBS

Immunogen POU class 3 homeobox 4 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Immunohistochemistry (1 paper)