Rabbit epithelium allergenic extract

Immunogen Recombinant protein corresponding to POU class 3 homeobox 4 Sequence SNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen Synthetic peptide directed towards the C terminal region of human POU4F1 Biochem/physiol Actions POU4F1 is a neural transcription factor that is involved in the development of sensory nervous system. POU domain factors are characterized

Immunogen Synthetic peptide directed towards the middle region of human POU4F3 Biochem/physiol Actions POU4F3 is capable of activating both BDNF and NT-3 promoters in inner ear sensory epithelial cell lines. Mutant POU4F3 loses most of its

POU class 4 homeobox 3 (POU4F3), also known as Brn-3c, is encoded by the gene mapped to human chromosome 5q32. The encoded protein belongs to the POU-domain class IV transcription factor family and is characterized by two DNA binding domains,

Immunogen protein phosphatase 2C-like domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen pyrophosphatase (inorganic) 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen pyrophosphatase (inorganic) 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

PPA2 pyrophosphatase (inorganic) 2 is a cardiomyopathy-associated protein, that codes for the mitochondrial pyrophosphatase. It is located on human chromosome 4q24.

Immunogen peter pan homolog ( Drosophila ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Lipid phosphate phosphatases (LPP) dephosphorylate a variety of bioactive lipids including phosphatidate, lysophosphatidate, sphingosine 1-phosphate, and ceramide 1-phosphate. The lipid phosphate phosphatase phosphatidic acid phosphatase type

Immunogen peroxisome proliferator-activated receptor gamma Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen peroxisome proliferator-activated receptor gamma Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive