-
HPA047248-100UL
Anti-PPP1R10 antibody produced in rabbit (C15-1459-183)
Price: $928.29List Price: $1,031.43Immunogen protein phosphatase 1, regulatory subunit 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA056756-100UL
Anti-PPP1R10 antibody produced in rabbit (C15-1462-441)
Price: $928.29List Price: $1,031.43Immunogen protein phosphatase 1, regulatory subunit 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA039068-100UL
Anti-PPP1R32 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Uncharacterized protein C11orf66 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA070440-100UL
ANTI-PPP1R3A ANTIBODY PRODUCED IN RABBIT (C15-1465-847)
Price: $977.14List Price: $1,085.71Immunogen protein phosphatase 1 regulatory subunit 3A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA073138-100UL
ANTI-PPP1R3A ANTIBODY PRODUCED IN RABBIT (C15-1466-317)
Price: $977.14List Price: $1,085.71Immunogen protein phosphatase 1 regulatory subunit 3A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA061600-100UL
Anti-PPP1R3E antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen protein phosphatase 1, regulatory subunit 3E Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA027406-100UL
Anti-PPP1R8 antibody produced in rabbit (C15-1451-476)
Price: $879.43List Price: $977.14Immunogen Nuclear inhibitor of protein phosphatase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA027417-100UL
Anti-PPP1R8 antibody produced in rabbit (C15-1451-480)
Price: $879.43List Price: $977.14Immunogen Nuclear inhibitor of protein phosphatase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA027452-100UL
Anti-PPP1R8 antibody produced in rabbit (C15-1451-505)
Price: $879.43List Price: $977.14The gene PPP1R8 (protein phosphatase 1 regulatory inhibitor subunit 8) is mapped to human chromosome 1p35. The encoded protein has a PP1 (protein phosphatase 1)-anchoring domain, a forkhead-associated (FHA) domain and a PP1-inhibitory domain. -
HPA027726-100UL
Anti-PPP1R9A antibody produced in rabbit (C15-1451-589)
Price: $879.43List Price: $977.14Immunogen Neurabin-1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA075591-100UL
Anti-PPP1R9A antibody produced in rabbit (C15-1466-759)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to protein phosphatase 1 regulatory subunit 9A Sequence KTKEGEGSQQSRGRKYGSNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSVSERIS Application All Prestige Antibodies Powered by Atlas Antibodies -
HPA018908-100UL
Anti-PPP2R1B antibody produced in rabbit
Price: $879.43List Price: $977.14The gene protein phosphatase 2A subunit A isoform R1-β (PPP2R1B) is mapped to human chromosome 11q22-23. It belongs to the huntington-elongation-A subunit-TOR (HEAT) repeat protein family.