-
Add to Cart The item has been addedHPA060566-100ULAnti-PRRG3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen proline rich Gla (G-carboxyglutamic acid) 3 (transmembrane) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA063566-100ULAnti-PRRX1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to paired related homeobox 1 Sequence NERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLHE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA006607-100ULAnti-PRRX2 antibody produced in rabbit (C15-1446-675)
Price: $879.43List Price: $977.14Immunogen paired related homeobox 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA026808-100ULAnti-PRRX2 antibody produced in rabbit (C15-1451-213)
Price: $879.43List Price: $977.14Paired related homeobox 2 (PRRX2) is a member of PRRX gene family, which is encoded by a gene mapped to human chromosome 9q34.1. -
Add to Cart The item has been addedHPA063471-100ULAnti-PRSS1 antibody produced in rabbit
Price: $977.14List Price: $1,085.71Immunogen protease, serine, 1 (trypsin 1) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA058082-100ULAnti-PRSS33 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen protease, serine, 33 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA028003-100ULAnti-PRSS38 antibody produced in rabbit (C15-1451-681)
Price: $879.43List Price: $977.14Immunogen Serine protease MPN2 Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA055809-100ULAnti-PRSS38 antibody produced in rabbit (C15-1462-138)
Price: $928.29List Price: $1,031.43Immunogen protease, serine, 38 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA060284-100ULAnti-PRSS45 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen protease, serine, 45 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA030436-100ULAnti-PRSS8 antibody produced in rabbit
Price: $977.14List Price: $1,085.71Immunogen protease, serine, 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA001868-100ULAnti-PRX antibody produced in rabbit
Price: $977.14List Price: $1,085.71Immunogen Periaxin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA046366-100ULAnti-PRY antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen PTPN13-like, Y-linked recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by
