-
Add to Cart The item has been addedHPA044220-100ULAnti-PSMD9 antibody produced in rabbit (C15-1458-074)
Price: $928.29List Price: $1,031.43Immunogen proteasome (prosome, macropain) 26S subunit, non-ATPase, 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA060922-100ULAnti-PSME4 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen proteasome (prosome, macropain) activator subunit 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA020376-100ULAnti-PSPH antibody produced in rabbit (C15-1449-581)
Price: $879.43List Price: $977.14Phosphoserine phosphatase (PSPH) is an Mg 2+ -dependent enzyme having a molecular mass of 25kDa. It belongs to the haloacid dehalogenase (HAD) superfamily and possesses 225 amino acids. -
Add to Cart The item has been addedHPA029515-100ULAnti-PSPH antibody produced in rabbit (C15-1452-303)
Price: $879.43List Price: $977.14Immunogen phosphoserine phosphatase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA049315-100ULAnti-PSRC1 antibody produced in rabbit (C15-1459-892)
Price: $928.29List Price: $1,031.43Immunogen proline/serine-rich coiled-coil 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA056561-100ULAnti-PSRC1 antibody produced in rabbit (C15-1462-391)
Price: $928.29List Price: $1,031.43Immunogen proline/serine-rich coiled-coil 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedAV31807-100ULAnti-PTDSR (AB1) antibody produced in rabbit
Price: $898.29List Price: $998.10PTDSR is a nuclear protein that has a JmjC domain. This protein has been shown to function as a lysyl-5-hydroxylase that is involved in alternative RNA splicing. -
Add to Cart The item has been addedHPA038044-100ULAnti-PTER antibody produced in rabbit (C15-1455-040)
Price: $928.29List Price: $1,031.43Immunogen phosphotriesterase related Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA038045-100ULAnti-PTER antibody produced in rabbit (C15-1455-041)
Price: $928.29List Price: $1,031.43Immunogen phosphotriesterase related recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA014193-100ULAnti-PTGIS antibody produced in rabbit (C15-1448-084)
Price: $879.43List Price: $977.14The gene PTGIS (prostaglandin I2 synthase) encodes a protein belonging to the cytochrome P450 superfamily of enzymes. The encoded protein is also referred to as prostacyclin synthase. -
Add to Cart The item has been addedHPA052244-100ULAnti-PTGIS antibody produced in rabbit (C15-1460-953)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to prostaglandin I2 synthase Sequence GYALDFGKDAASFLTRMKEKHGDIFTILVGGRYVTVLLDPHSYDAVVWEPRTRLDFHAYAIFLMERIFDVQLPHYSPSDEKARMKLTLLHRELQALTEAMYTNLHAVLLGDATEAGSGWHEMGLLDFSYSFLLR Application All Prestige -
Add to Cart The item has been addedHPA048540-100ULAnti-PTH antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen parathyroid hormone Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
