-
Add to Cart The item has been addedHPA007978-100ULAnti-PTH1R antibody produced in rabbit (C15-1447-019)
Price: $879.43List Price: $977.14PTH1R (parathyroid hormone 1 receptor) gene encodes a member of the G-protein coupled receptor family B or secretin family GPCRs. These receptors have an N-terminal extracellular domain (ECD) spanning a length of 160 amino acids and a 7-TM domain. -
Add to Cart The item has been addedHPA075879-100ULANTI-PTH1R ANTIBODY PRODUCED IN RABBIT (C15-1466-791)
Price: $977.14List Price: $1,085.71Immunogen parathyroid hormone 1 receptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA010655-100ULAnti-PTH2R antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen parathyroid hormone 2 receptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA047183-100ULAnti-PTMA antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen prothymosin, alpha recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA073913-100ULANTI-PTN ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen pleiotrophin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA005695-100ULAnti-PTPA antibody produced in rabbit
Price: $879.43List Price: $977.14Serine/threonine-protein phosphatase 2A activator (PPP2R4) has been classified as a subunit of serine/threonine-protein phosphatase (PP2A). It has three subdomains- a core, a lid and a linker. -
Add to Cart The item has been addedHPA063119-100ULANTI-PTPN13 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen protein tyrosine phosphatase, non-receptor type 13 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA041922-100ULAnti-PTPN9 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen protein tyrosine phosphatase, non-receptor type 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedHPA019951-100ULAnti-PTRHD1 antibody produced in rabbit
Price: $879.43List Price: $977.14PTRHD1 (Peptidyl-tRNA hydrolase domain containing 1) is located on chromosome 2p23. Its function is unknown. -
Add to Cart The item has been addedHPA072672-100ULAnti-PUDP antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to pseudouridine 5′-phosphatase Sequence LVEESQTKLKEVFPTAALMPGAEKLIIHLRKHGIPFALATSSGSASFDMKTSRHKEFFSLFSHIVLGDDPEVQHGEPDPDIFLACAKRFSPPPAMEKCLVFEDAPNGVEAALAAGMQVVMVPD Application All Prestige -
Add to Cart The item has been addedHPA052096-100ULAnti-PUF60 antibody produced in rabbit (C15-1460-902)
Price: $928.29List Price: $1,031.43Immunogen poly-U binding splicing factor 60KDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA059714-100ULAnti-PUF60 antibody produced in rabbit (C15-1463-356)
Price: $928.29List Price: $1,031.43Immunogen poly-U binding splicing factor 60KDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
