-
HPA027715-100UL
Anti-RABIF antibody produced in rabbit (C15-1451-587)
Price: $879.43List Price: $977.14Immunogen RAB interacting factor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA054936-100UL
Anti-RABIF antibody produced in rabbit (C15-1461-834)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to RAB interacting factor Sequence GDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
HPA006692-100UL
Anti-RAD1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen RAD1 checkpoint DNA exonuclease Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA006725-100UL
Anti-RAD9A antibody produced in rabbit (C15-1446-707)
Price: $879.43List Price: $977.14Immunogen Cell cycle checkpoint control protein RAD9A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA048155-100UL
Anti-RAD9A antibody produced in rabbit (C15-1459-470)
Price: $928.29List Price: $1,031.43Immunogen RAD9 checkpoint clamp component A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA040643-100UL
Anti-RAD9B antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen RAD9 homolog B ( S. pombe ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA051776-100UL
Anti-RADIL antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Ras association and DIL domains recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA054022-100UL
Anti-RAET1E antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen retinoic acid early transcript 1E recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA065704-100UL
Anti-RAG2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to recombination activating 2 Sequence HGGKTPNNEVSDKIYVMSIVCKNNKKVTFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGVLFGGRSYMPSTHRTTEKWNSVADCLPCVFLVDF Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA054906-100UL
Anti-RAI1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen retinoic acid induced 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA051054-100UL
Anti-RAI2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen retinoic acid induced 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA047037-100UL
ANTI-RALA ANTIBODY PRODUCED IN RABBIT (C15-1459-101)
Price: $977.14List Price: $1,085.71Immunogen RAS like proto-oncogene A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the