-
HPA041343-100UL
Anti-RTTN antibody produced in rabbit (C15-1456-643)
Price: $928.29List Price: $1,031.43Immunogen rotatin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA041967-100UL
Anti-RTTN antibody produced in rabbit (C15-1456-988)
Price: $928.29List Price: $1,031.43Immunogen rotatin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
AV38073-100UL
Anti-RUNX1 antibody produced in rabbit (C15-1341-075)
Price: $898.29List Price: $998.10Runt-related transcription factor 1 (RUNX1) is a transcription factor that plays an important role in hematopoiesis, osteogenesis and neurogenesis. It is a member of Runt-related transcription factors (RUNXs). -
HPA004176-100UL
Anti-RUNX1 antibody produced in rabbit (C15-1446-180)
Price: $879.43List Price: $977.14Runt-related transcription factor 1 (RUNX1) is a transcription factor that crucially performs in hematopoiesis, osteogenesis and neurogenesis. It is a member of Runt-related transcription factors (RUNXs). -
HPA037912-100UL
Anti-RUNX1 antibody produced in rabbit (C15-1454-970)
Price: $928.29List Price: $1,031.43Immunogen runt-related transcription factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA049852-100UL
Anti-RUNX1T1 antibody produced in rabbit (C15-1460-094)
Price: $928.29List Price: $1,031.43Immunogen runt-related transcription factor 1 translocated to, 1 (cyclin D-related) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA070951-100UL
Anti-RUNX1T1 antibody produced in rabbit (C15-1465-933)
Price: $928.29List Price: $1,031.43Immunogen runt-related transcription factor 1 translocated to, 1 (cyclin D-related) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA022040-100UL
Anti-RUNX2 antibody produced in rabbit
Price: $977.14List Price: $1,085.71Runt-related transcription factor 2/acute myeloid leukemia 3 protein (RUNX2, AML-3) belongs to Runt DNA-binding domain transcription factor family. RUNX2 gene is mapped to human chromosome 6p21. -
HPA059006-100UL
Anti-RUNX3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen runt-related transcription factor 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA056416-100UL
Anti-RYR1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ryanodine receptor 1 (skeletal) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA062004-100UL
Anti-RYR3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to ryanodine receptor 3. Sequence TMDSPPCLKVTHKTFGTQNSNADMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEILSHTTTQCYYAIRIFAGQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
HPA045841-100UL
Anti-S100A16 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen S100 calcium binding protein A16 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are