-
HPA027328-100UL
Anti-S100PBP antibody produced in rabbit (C15-1451-436)
Price: $879.43List Price: $977.14Immunogen S100P binding protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA051929-100UL
Anti-S100Z antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to S100 calcium binding protein Z Sequence MPTQLEMAMDTMIRIFHRYSGKARKRFKLS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA060139-100UL
Anti-SAA4 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen serum amyloid A4, constitutive Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA039003-100UL
Anti-SAAL1 antibody produced in rabbit (C15-1455-540)
Price: $928.29List Price: $1,031.43Immunogen serum amyloid A-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA039004-100UL
Anti-SAAL1 antibody produced in rabbit (C15-1455-541)
Price: $928.29List Price: $1,031.43Immunogen serum amyloid A-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA039573-100UL
Anti-SACM1L antibody produced in rabbit (C15-1455-804)
Price: $928.29List Price: $1,031.43SAC1 like phosphatidylinositide phosphatase (SACM1L) is a phosphatidylinositol-4 phosphate (PI4P) lipid phosphatase, encoded by the gene mapped to human chromosome 3p21.31. -
HPA069869-100UL
Anti-SACM1L antibody produced in rabbit (C15-1465-773)
Price: $928.29List Price: $1,031.43Immunogen SAC1 suppressor of actin mutations 1-like (yeast) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA041906-100UL
Anti-SAE1 antibody produced in rabbit (C15-1456-951)
Price: $928.29List Price: $1,031.43Immunogen SUMO1 activating enzyme subunit 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA043552-100UL
Anti-SAE1 antibody produced in rabbit (C15-1457-754)
Price: $928.29List Price: $1,031.43Immunogen SUMO1 activating enzyme subunit 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA004946-100UL
Anti-SAG antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen S-antigen retina and pineal gland (arrestin) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA041662-100UL
Anti-SAMD1 antibody produced in rabbit (C15-1456-820)
Price: $928.29List Price: $1,031.43Immunogen sterile alpha motif domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA049059-100UL
Anti-SAMD1 antibody produced in rabbit (C15-1459-804)
Price: $928.29List Price: $1,031.43Immunogen sterile alpha motif domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a