-
HPA071194-100UL
Anti-SCNN1G antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen sodium channel, non voltage gated 1 gamma subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA021565-100UL
Anti-SCO1 antibody produced in rabbit (C15-1449-920)
Price: $879.43List Price: $977.14SCO1 (synthesis of cytochrome c oxidase 1) is a protein encoded by SCO1 gene, which is mapped to human chromosome 17p13.1. -
HPA021579-100UL
Anti-SCO1 antibody produced in rabbit (C15-1449-927)
Price: $879.43List Price: $977.14Immunogen Protein SCO1 homolog, mitochondrial Precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA046943-100UL
Anti-SCO2 antibody produced in rabbit (C15-1459-060)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to SCO2, cytochrome c oxidase assembly protein Sequence PTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRG Application All Prestige Antibodies Powered -
HPA056254-100UL
Anti-SCO2 antibody produced in rabbit (C15-1462-290)
Price: $928.29List Price: $1,031.43Immunogen SCO2, cytochrome c oxidase assembly protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA061198-100UL
Anti-SCOC antibody produced in rabbit (C15-1463-720)
Price: $928.29List Price: $1,031.43Immunogen short coiled-coil protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA070321-100UL
Anti-SCOC antibody produced in rabbit (C15-1465-824)
Price: $928.29List Price: $1,031.43Immunogen short coiled-coil protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA027101-100UL
Anti-SCP2 antibody produced in rabbit (C15-1451-319)
Price: $879.43List Price: $977.14Immunogen Non-specific lipid-transfer protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA027135-100UL
Anti-SCP2 antibody produced in rabbit (C15-1451-335)
Price: $879.43List Price: $977.14Immunogen Non-specific lipid-transfer protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA027317-100UL
Anti-SCP2 antibody produced in rabbit (C15-1451-431)
Price: $879.43List Price: $977.14Immunogen sterol carrier protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA039102-100UL
Anti-SCPEP1 antibody produced in rabbit (C15-1455-580)
Price: $928.29List Price: $1,031.43Immunogen serine carboxypeptidase 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA057200-100UL
Anti-SCPEP1 antibody produced in rabbit (C15-1462-583)
Price: $928.29List Price: $1,031.43Immunogen serine carboxypeptidase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the