Rabbit epithelium allergenic extract

Immunogen sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

The semaphorins contain a 500 amino acid conserved domain that forms a seven-bladed &#946-propeller structure. They are involved in cell-migration, angiogenesis, and immune response and are divided into seven classes.

SEMA4C (semaphorin 4C) is a transmembrane neural protein which belongs to the family of semaphorin proteins. It has a cytoplasmic domain made of 146 amino acids, which has a proline rich region.

Immunogen Semaphorin-4D precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

The gene SEMA4D (semaphorin 4D) is mapped to human chromosome 9q22. SEMA4D transcripts are mainly expressed in the skeletal muscle, peripheral blood lymphocytes, spleen and thymus.

Immunogen Recombinant protein corresponding to ssemaphorin 4F Sequence DVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLNGPFRELKHDCNRGLPVVDNDVPQPR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

SEMA5A (semaphorin 5A), a transmembrane bound, glycosylphospatidylinositol-anchored, semaphorin protein, belongs to the semaphorin gene family. It consists of a semaphorin domain in the amino-terminal region and subfamily-specific domains at

Immunogen semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen SUMO/sentrin specific peptidase family member 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as