-
HPA068262-100UL
Anti-SERTAD3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen SERTA domain containing 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA027344-100UL
Anti-SERTAD4 antibody produced in rabbit (C15-1451-449)
Price: $879.43List Price: $977.14Immunogen SERTA domain containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA028514-100UL
Anti-SERTAD4 antibody produced in rabbit (C15-1451-879)
Price: $879.43List Price: $977.14Immunogen SERTA domain containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA073659-100UL
Anti-SESN1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen sestrin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA058236-100UL
Anti-SESTD1 antibody produced in rabbit (C15-1462-877)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to SEC14 and spectrin domain containing 1 Sequence PQVMKLLDSLREQYTRYQEVCRQRSKRTQLEEIQQKVMQVVNWLEGPGSEQLRAQWGIGDSIRASQALQQKHEEIESQHSEWFAVYVEL Application All Prestige Antibodies Powered by Atlas Antibodies -
HPA077408-100UL
Anti-SESTD1 antibody produced in rabbit (C15-1467-033)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to SEC14 and spectrin domain containing 1 Sequence WNVVKTVVVMLQNVVPAEVSLVCVVKPDEFWDKKVTHFCFWKEKDRLGFEVILVSANKLTRYIEPCQLTEDFGGSL Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA058376-100UL
Anti-SETD1A antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen SET domain containing 1A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA057999-100UL
Anti-SETMAR antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen SET domain and mariner transposase fusion gene Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA024105-100UL
Anti-SETX antibody produced in rabbit (C15-1450-630)
Price: $879.43List Price: $977.14Immunogen senataxin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA057269-100UL
Anti-SETX antibody produced in rabbit (C15-1462-605)
Price: $928.29List Price: $1,031.43Immunogen senataxin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
AV40526-100UL
Anti-SFRS8 antibody produced in rabbit
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the N terminal region of human SFRS8 Biochem/physiol Actions SFRS8 is a human homolog of Drosophila splicing regulatory protein.This gene encodes a human homolog of Drosophila splicing regulatory protein. -
HPA074790-100UL
Anti-SGCE antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen sarcoglycan, epsilon Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the