Rabbit epithelium allergenic extract

Immunogen Src-like-adaptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Src-like-adaptor 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Src-like-adaptor 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen SLAM family member 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Synthetic peptide directed towards the middle region of human SLC16A8 Application Anti-SLC16A8 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5&#956g/ml and for immunohistochemistry of

Immunogen Recombinant protein corresponding to solute carrier family 16 (monocarboxylate transporter), member 8 Sequence KAAPSGPGTEGGASDTEDAEAEGDSEPLPVVAEEPGNLGALEVLSARGEPTEPEI Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen solute carrier family 16, member 9 (monocarboxylic acid transporter 9) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen Recombinant protein corresponding to solute carrier family 18 member A2 Sequence MAILMDHNCPIKTKMYTQNNIQSYPIGEDEESESD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Excitatory amino acid transporter 2 (EAAT2) is a membrane glutamate transporter. This gene localizes to human chromosome 11p13-12.

Immunogen solute carrier family 1 member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Solute carrier family 1 (glutamate/neutral amino acid transporter), member 4 (ASCT1, SATT, SLC1A4) is a sodium dependent concentrative transporter of neutral amino acids such as alanine, glutamate, serine, cysteine and the imino acids,

Immunogen Recombinant protein corresponding to solute carrier family 1 (glutamate/neutral amino acid transporter), member 4. Sequence KPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLA Application All Prestige Antibodies Powered by Atlas Antibodies are developed