-
Add to Cart The item has been addedHPA034964-100ULAnti-SLC1A4 antibody produced in rabbit (C15-1453-618)
Price: $889.20List Price: $988.00Immunogen solute carrier family 1 (glutamate/neutral amino acid transporter), member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA006539-100ULAnti-SLC2A3 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Solute carrier family 2, facilitated glucose transporter member 3 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are -
Add to Cart The item has been addedHPA063050-100ULAnti-SLC2A4RG antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen SLC2A4 regulator Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA011935-100ULAnti-SLC2A8 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Solute carrier family 2, facilitated glucose transporter member 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA066229-100ULAnti-SLC2A9 antibody produced in rabbit (C15-1465-050)
Price: $928.29List Price: $1,031.43Immunogen solute carrier family 2 (facilitated glucose transporter), member 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA075669-100ULANTI-SLC2A9 ANTIBODY PRODUCED IN RABBIT (C15-1466-769)
Price: $977.14List Price: $1,085.71Immunogen solute carrier family 2 member 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedAV44019-100ULAnti-SLC30A1 antibody produced in rabbit (C15-1341-474)
Price: $898.29List Price: $998.10Solute carrier family 30, member 1 (SLC30A1, ZNT1, ZRC1) is a zinc transporter involved in regulating zinc and other divalent cation flux. SLC30A1/ ZNT1 is frequently coexpressed with L-type voltage-dependent calcium channel (LTCC), a major route -
Add to Cart The item has been addedHPA015275-100ULAnti-SLC30A1 antibody produced in rabbit (C15-1448-322)
Price: $879.43List Price: $977.14SLC30A1 (solute carrier family 30, member 1) is a transmembrane transporter of the zinc-regulating family of proteins. It has a wide range of tissue expression, with predominant expression in brain, heart, pancreas and testis. -
Add to Cart The item has been addedHPA049000-100ULAnti-SLC30A1 antibody produced in rabbit (C15-1459-784)
Price: $928.29List Price: $1,031.43Immunogen solute carrier family 30 (zinc transporter), member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA064547-100ULAnti-SLC30A10 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to solute carrier family 30 member 10 Sequence SDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRGVL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been addedHPA004014-100ULAnti-SLC30A9 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Solute carrier family 30 (zinc transporter), member 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been addedHPA059985-100ULAnti-SLC32A1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen solute carrier family 32 member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
