Rabbit epithelium allergenic extract

Immunogen solute carrier family 33 (acetyl-CoA transporter), member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen Recombinant protein corresponding to solute carrier family 33 member 1 Sequence PGGWDDSHLDSAGREGDREALLGDTGTGDFLKAPQSFRAELS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Solute carrier family 38, member 1/sodium-coupled neutral amino acid transporter 1 (SLC38A1, ATA1, NAT2, SAT1, SNAT1), which is expressed during embryogenesis, is a sodium-dependent transporter of neutral zwitterionic amino acids, such a glutamine.

Immunogen solute carrier family 38, member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

SLC38A10 is a gene encoding for the protein sodium-coupled neutral amino acid transporter 10. This protein belongs to SLC38 gene family.

The gene SLC38A10 (solute carrier family 38 member 10) encodes two transcripts with the help of exon skipping. The gene is mapped to human chromosome 17q25.

The gene SLC38A10 (solute carrier family 38 member 10) encodes two transcripts with the help of exon skipping. The gene is mapped to human chromosome 17q25.

Solute carrier family 38 member 11 (SLC38A11) is encoded by the gene mapped to human chromosome 2q24.3.

Immunogen solute carrier family 38, member 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Synthetic peptide directed towards the N terminal region of human SLC38A3 Biochem/physiol Actions As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for

Immunogen solute carrier family 38, member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen Synthetic peptide directed towards the middle region of human SLC38A4 Biochem/physiol Actions SLC38A4 is found predominantly in liver and transports both cationic and neutral amino acids. The transport of cationic amino acids by SLC38A4