-
Add to Cart The item has been addedHPA060198-100ULAnti-SMOX antibody produced in rabbit (C15-1463-473)
Price: $928.29List Price: $1,031.43Immunogen spermine oxidase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA046279-100ULAnti-SMPD4 antibody produced in rabbit (C15-1458-798)
Price: $928.29List Price: $1,031.43Immunogen sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA049426-100ULAnti-SMPD4 antibody produced in rabbit (C15-1459-947)
Price: $928.29List Price: $1,031.43Immunogen sphingomyelin phosphodiesterase 4, neutral membrane (neutral sphingomyelinase-3) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA077360-100ULAnti-SMPX antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to small muscle protein, X-linked Sequence ANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been addedHPA051778-100ULAnti-SMTN antibody produced in rabbit (C15-1460-787)
Price: $928.29List Price: $1,031.43Immunogen smoothelin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA058590-100ULAnti-SMTN antibody produced in rabbit (C15-1462-998)
Price: $928.29List Price: $1,031.43The smoothelin (SMTN) gene is mapped to human chromosome 22q12.2. -
Add to Cart The item has been addedHPA019228-100ULAnti-SMU1 antibody produced in rabbit (C15-1449-264)
Price: $879.43List Price: $977.14SMU1 (suppressor of mec-8 and unc-52) belongs to the WD40 (β-transducin)-repeat protein family. Immunogen WD40 repeat-containing protein SMU1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by -
Add to Cart The item has been addedHPA019708-100ULAnti-SMU1 antibody produced in rabbit (C15-1449-397)
Price: $879.43List Price: $977.14SMU1 (Smu-1 suppressor of mec-8 and unc-52 homolog, C. elegans ) is an evolutionarily conserved gene belonging to the WD40-repeat protein family. -
Add to Cart The item has been addedHPA026804-100ULANTI-SMUG1 ANTIBODY PRODUCED IN RABBIT (C15-1451-212)
Price: $977.14List Price: $1,085.71Immunogen single-strand-selective monofunctional uracil-DNA glycosylase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA065892-100ULANTI-SMUG1 ANTIBODY PRODUCED IN RABBIT (C15-1464-981)
Price: $977.14List Price: $1,085.71Immunogen single-strand-selective monofunctional uracil-DNA glycosylase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA071508-100ULAnti-SMURF2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen SMAD specific E3 ubiquitin protein ligase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA062282-100ULAnti-SMYD1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen SET and MYND domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in
