-
Add to Cart The item has been addedHPA045821-100ULAnti-SMYD3 antibody produced in rabbit (C15-1458-649)
Price: $928.29List Price: $1,031.43Immunogen SET and MYND domain containing 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA054352-100ULAnti-SMYD3 antibody produced in rabbit (C15-1461-650)
Price: $928.29List Price: $1,031.43Immunogen SET and MYND domain containing 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA015514-100ULAnti-SMYD5 antibody produced in rabbit (C15-1448-353)
Price: $879.43List Price: $977.14Immunogen SMYD family member 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA049002-100ULAnti-SMYD5 antibody produced in rabbit (C15-1459-786)
Price: $928.29List Price: $1,031.43Immunogen SMYD family member 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA064687-100ULAnti-SNCAIP antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen synuclein, alpha interacting protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA035876-100ULAnti-SNCB antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen synuclein, beta recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA014404-100ULAnti-SNCG antibody produced in rabbit
Price: $879.43List Price: $977.14The gene SNCG (synuclein γ) is a breast cancer specific gene that encodes a member of the synuclein family of proteins. SNCG mRNA is not found in normal or benign breast tissue. -
Add to Cart The item has been addedHPA002529-100ULAnti-SND1 antibody produced in rabbit (C15-1445-598)
Price: $879.43List Price: $977.14Immunogen Staphylococcal nuclease domain-containing protein 1 recombinant protein epitope signature tag (PrEST) Sequence ARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKEL Application All -
Add to Cart The item has been addedHPA002632-100ULAnti-SND1 antibody produced in rabbit (C15-1445-619)
Price: $879.43List Price: $977.14Staphylococcal nuclease and tudor domain containing 1 (SND1) is the conserved single-stranded cytosine-rich DNA binding protein that binds to the d(CTGCC)n sequence. It is composed of five repeated staphylococcal nuclease homology domains and a -
Add to Cart The item has been addedHPA036414-100ULAnti-SNED1 antibody produced in rabbit (C15-1454-343)
Price: $928.29List Price: $1,031.43Immunogen sushi, nidogen and EGF-like domains 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA036415-100ULAnti-SNED1 antibody produced in rabbit (C15-1454-344)
Price: $928.29List Price: $1,031.43Immunogen sushi, nidogen and EGF-like domains 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA059320-100ULAnti-SNF8 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen SNF8, ESCRT-II complex subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in
