-
HPA042856-100UL
ANTI-SOSTDC1 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen sclerostin domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA036809-100UL
Anti-SOWAHB antibody produced in rabbit (C15-1454-560)
Price: $928.29List Price: $1,031.43Immunogen ankyrin repeat domain 56 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA036810-100UL
Anti-SOWAHB antibody produced in rabbit (C15-1454-561)
Price: $928.29List Price: $1,031.43Immunogen sosondowah ankyrin repeat domain family member B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA056131-100UL
Anti-SOWAHC antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen sosondowah ankyrin repeat domain family member C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA058665-100UL
Anti-SOX8 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen SRY (sex determining region Y)-box 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA047036-100UL
Anti-SP110 antibody produced in rabbit (C15-1459-100)
Price: $928.29List Price: $1,031.43Immunogen SP110 nuclear body protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA058554-100UL
Anti-SP110 antibody produced in rabbit (C15-1462-985)
Price: $928.29List Price: $1,031.43Immunogen SP110 nuclear body protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA032146-100UL
Anti-SP3 antibody produced in rabbit
Price: $889.20List Price: $988.00Immunogen Recombinant protein corresponding to Sp3 transcription factor Sequence VQTLTLGQVAAGGAFTSTPVSLSTGQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQ Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA054006-100UL
Anti-SP8 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Sp8 transcription factor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA062616-100UL
Anti-SP9 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Sp9 transcription factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA046423-100UL
Anti-SPANXC antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen SPANX family, member C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA045730-100UL
Anti-SPANXN4 antibody produced in rabbit (C15-1458-627)
Price: $947.83List Price: $1,053.14Immunogen SPANX family, member N4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported