-
Add to Cart The item has been addedHPA022990-100ULAnti-SPOUT1 antibody produced in rabbit (C15-1450-201)
Price: $879.43List Price: $977.14The gene C9orf114 (chromosome 9 open reading frame 114) is mapped to human chromosome 9q34. It is a kinetochore-associated protein. -
Add to Cart The item has been addedHPA076946-100ULANTI-SPOUT1 ANTIBODY PRODUCED IN RABBIT (C15-1466-966)
Price: $977.14List Price: $1,085.71Immunogen SPOUT domain containing methyltransferase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA039505-100ULAnti-SPR antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen sepiapterin reductase (7,8-dihydrobiopterin:NADP+ oxidoreductase) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA055963-100ULAnti-SPRR4 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen small proline-rich protein 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA025073-100ULAnti-SPRTN antibody produced in rabbit
Price: $879.43List Price: $977.14C1orf124/Spartan, a protein that contains a PCNA-interacting peptide motif, called a PIP box, and a UBZ4 ubiquitin-binding domain, is involved in Rad18-mediated Proliferating Cell Nuclear Antigen (PCNA) ubiquitination and the regulation of DNA -
Add to Cart The item has been addedAV50519-100ULAnti-SPRY3 antibody produced in rabbit
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human SPRY3 Application Anti-SPRY3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml. -
Add to Cart The item has been addedHPA055471-100ULAnti-SPRY4 antibody produced in rabbit (C15-1462-026)
Price: $928.29List Price: $1,031.43Immunogen sprouty RTK signaling antagonist 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA072661-100ULAnti-SPRY4 antibody produced in rabbit (C15-1466-256)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to sprouty RTK signaling antagonist 4 Sequence SSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been addedHPA039426-100ULAnti-SPRYD3 antibody produced in rabbit (C15-1455-730)
Price: $928.29List Price: $1,031.43Immunogen SPRY domain containing 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA039685-100ULAnti-SPRYD3 antibody produced in rabbit (C15-1455-846)
Price: $928.29List Price: $1,031.43Immunogen SPRY domain containing 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA053469-100ULAnti-SPRYD4 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen SPRY domain containing 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA043934-100ULAnti-SPRYD7 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen SPRY domain containing 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported
