-
Add to Cart The item has been addedHPA054824-100ULAnti-ABR antibody produced in rabbit (C15-1461-807)
Price: $928.29List Price: $1,031.43Immunogen active BCR-related recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedAV35033-100ULAnti-ACCN1 antibody produced in rabbit
Price: $819.43List Price: $910.48ACCN1 (or ASIC2) codes for a protein that belongs to the degenerin/epithelial sodium channel (DEG/ENaC) family. ACCN1 may be involved in neurotransmission. -
Add to Cart The item has been addedHPA018873-100ULAnti-ACCS antibody produced in rabbit (C15-1449-117)
Price: $879.43List Price: $977.14The gene ACCS (1-aminocyclopropane-1-carboxylate synthase-like protein 1) is mapped to human chromosome 11p11.2. -
Add to Cart The item has been addedHPA021654-100ULAnti-ACCS antibody produced in rabbit (C15-1449-962)
Price: $879.43List Price: $977.14ACCS (1-aminocyclopropane-1-carboxylate synthase-like protein 1) is a member of a-family of PLP (pyridoxal-5′-phosphate)-dependent enzyme family. It is mapped to human chromosome 11p11. -
Add to Cart The item has been addedHPA065042-100ULANTI-ACCSL ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen 1-aminocyclopropane-1-carboxylate synthase homolog (inactive) like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA029298-100ULAnti-ACE antibody produced in rabbit (C15-1452-211)
Price: $879.43List Price: $977.14ACE gene codes for angiotensin-converting enzyme (ACE). It is the main enzyme in the RAS (renin angiotensin system). -
Add to Cart The item has been addedHPA069790-100ULAnti-ACE antibody produced in rabbit (C15-1465-749)
Price: $928.29List Price: $1,031.43Immunogen angiotensin I converting enzyme Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA070087-100ULAnti-ACER3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to alkaline ceramidase 3 Sequence DREGYWGPTTSTLDWCEENYSVTWYIAEFWNTVSNLIMIIPPMFGAVQSVRDGLEKR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedH9161-200ULAnti-acetyl- & phospho-Histone H3 (Ac-Lys9, pSer10) antibody produced in rabbit
Price: $1,056.00List Price: $1,173.33Anti-Acetyl & Phospho Histone H3 [Ac-Lys9, pSer10] is developed in rabbit using a synthetic, acetylated and phosphorylated [Ac-Lys, pSer10] histone H3 peptide (amino acids 7-20) corresponding to the N-terminus of human histone H3 conjugated to -
Add to Cart The item has been addedHPA027098-100ULAnti-ACHE antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen acetylcholinesterase (Yt blood group) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA048687-100ULAnti-ACR antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen acrosin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA038718-100ULAnti-ACRV1 antibody produced in rabbit (C15-1455-408)
Price: $928.29List Price: $1,031.43Immunogen acrosomal vesicle protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
