-
HPA017079-100UL
Anti-SQRDL antibody produced in rabbit (C15-1448-678)
Price: $879.43List Price: $977.14Immunogen Sulfide:quinone oxidoreductase, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
HPA041589-100UL
Anti-SQRDL antibody produced in rabbit (C15-1456-779)
Price: $928.29List Price: $1,031.43Immunogen sulfide quinone reductase-like (yeast) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA064165-100UL
Anti-SQSTM1 antibody produced in rabbit (C15-1464-572)
Price: $928.29List Price: $1,031.43Immunogen sequestosome 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
HPA068843-100UL
Anti-SQSTM1 antibody produced in rabbit (C15-1465-557)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to sequestosome 1 Sequence HGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
HPA044598-100UL
Anti-SRA1 antibody produced in rabbit (C15-1458-213)
Price: $928.29List Price: $1,031.43Immunogen steroid receptor RNA activator 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA050153-100UL
Anti-SRA1 antibody produced in rabbit (C15-1460-203)
Price: $928.29List Price: $1,031.43Immunogen steroid receptor RNA activator 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA019004-100UL
Anti-SRI antibody produced in rabbit (C15-1449-164)
Price: $879.43List Price: $977.14Immunogen sorcin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
HPA073666-100UL
Anti-SRI antibody produced in rabbit (C15-1466-420)
Price: $928.29List Price: $1,031.43Immunogen sorcin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
HPA015746-100UL
Anti-SRM antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Spermidine synthase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA007529-100UL
Anti-SRR antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen serine racemase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA042858-100UL
Anti-SRRT antibody produced in rabbit (C15-1457-409)
Price: $928.29List Price: $1,031.43Immunogen serrate, RNA effector molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA058379-100UL
Anti-SRRT antibody produced in rabbit (C15-1462-925)
Price: $928.29List Price: $1,031.43Immunogen serrate, RNA effector molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in