-
HPA045924-100UL
Anti-ARL8A antibody produced in rabbit (C15-1458-689)
Price: $928.29List Price: $1,031.43Immunogen ADP-ribosylation factor-like 8A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA072942-100UL
Anti-ARL9 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ADP-ribosylation factor-like 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA036996-100UL
Anti-ARMC8 antibody produced in rabbit (C15-1454-656)
Price: $928.29List Price: $1,031.43Immunogen armadillo repeat containing 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA044869-100UL
Anti-ARMC8 antibody produced in rabbit (C15-1458-313)
Price: $928.29List Price: $1,031.43Immunogen armadillo repeat containing 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA026671-100UL
Anti-ARMC9 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen LisH domain-containing protein ARMC9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA003004-100UL
Anti-ARMT1 antibody produced in rabbit (C15-1445-742)
Price: $879.43List Price: $977.14Immunogen acidic residue methyltransferase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA005819-100UL
Anti-ARMT1 antibody produced in rabbit (C15-1446-486)
Price: $879.43List Price: $977.14Immunogen acidic residue methyltransferase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA001759-100UL
Anti-ARNT antibody produced in rabbit
Price: $879.43List Price: $977.14Aryl hydrocarbon receptor nuclear translocator (ARNT) is part of the ligand generated complex of two basic helix-loop-helix (bHLH) / Per-Arnt-Sim (PAS) transcription factors. It belongs to the superfamily of regulatory proteins. -
HPA040513-100UL
Anti-ARPIN antibody produced in rabbit (C15-1456-239)
Price: $977.14List Price: $1,085.71Immunogen actin-related protein 2/3 complex inhibitor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA047173-100UL
Anti-ARPIN antibody produced in rabbit (C15-1459-161)
Price: $928.29List Price: $1,031.43Immunogen actin-related protein 2/3 complex inhibitor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA052278-100UL
Anti-ARPIN antibody produced in rabbit (C15-1460-967)
Price: $928.29List Price: $1,031.43Immunogen actin-related protein 2/3 complex inhibitor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA063129-100UL
Anti-ARR3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to arrestin 3 Sequence KDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)