-
Add to Cart The item has been addedHPA069752-100ULAnti-TCERG1 antibody produced in rabbit (C15-1465-743)
Price: $928.29List Price: $1,031.43Immunogen transcription elongation regulator 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA069808-100ULAnti-TCERG1 antibody produced in rabbit (C15-1465-757)
Price: $928.29List Price: $1,031.43Immunogen transcription elongation regulator 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA007342-100ULAnti-TCTA antibody produced in rabbit
Price: $879.43List Price: $977.14TCTA (T-cell leukemia translocation altered) gene is localized at the site of a t(13)(p34p21) translocation breakpoint in T-cell acute lymphoblastic leukemia. The gene is highly conserved from Drosophila to humans. -
Add to Cart The item has been addedHPA039687-100ULAnti-TCTN1 antibody produced in rabbit (C15-1455-848)
Price: $928.29List Price: $1,031.43Immunogen tectonic family member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA040036-100ULAnti-TCTN1 antibody produced in rabbit (C15-1456-031)
Price: $928.29List Price: $1,031.43Immunogen tectonic family member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA067153-100ULAnti-TDRD3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to tudor domain containing 3 Sequence PRFQRDSQNSKSVLEGSGLPRNRGSERPSTSSVSEVWAEDRIKCDRPYSRYDRTKDTSYPLGSQHSDGAFKKRDNSMQSRSGKGP Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA029418-100ULAnti-TDRD5 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen tudor domain containing 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA016419-100ULAnti-TDRKH antibody produced in rabbit (C15-1448-495)
Price: $879.43List Price: $977.14Immunogen Tudor and KH domain-containing protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA019625-100ULAnti-TDRKH antibody produced in rabbit (C15-1449-361)
Price: $879.43List Price: $977.14Immunogen Tudor and KH domain-containing protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA008462-100ULAnti-TDRP antibody produced in rabbit
Price: $879.43List Price: $977.14The gene encoding testis development related protein (TDRP) is located on chromosome 8 and encodes 198 amino acids. It is expressed in the cytoplasm and nuclei of spermatogenic cells, mainly in spermatocytes. -
Add to Cart The item has been addedAV39521-100ULAnti-TEAD1 (AB1) antibody produced in rabbit
Price: $898.29List Price: $998.10TEAD1 is a transcriptional factor that blocks the expression of prolactin in human uterine decidual cells. TEAD1 mutation has been linked to Sveinsson′s chorioretinal atrophy. -
Add to Cart The item has been addedHPA057339-100ULAnti-TEAD1 antibody produced in rabbit (C15-1462-632)
Price: $928.29List Price: $1,031.43Immunogen TEA domain family member 1 (SV40 transcriptional enhancer factor) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the
