-
HPA059756-100UL
Anti-THBS1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen thrombospondin 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA073242-100UL
Anti-THBS3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to thrombospondin 3 Sequence VGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
HPA028161-100UL
Anti-THEM4 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen thioesterase superfamily member 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA031422-100UL
Anti-THEMIS antibody produced in rabbit (C15-1453-112)
Price: $889.20List Price: $988.00Immunogen thymocyte selection associated Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA031425-100UL
Anti-THEMIS antibody produced in rabbit (C15-1453-113)
Price: $889.20List Price: $988.00Immunogen thymocyte selection associated recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA027513-100UL
ANTI-THEMIS2 ANTIBODY PRODUCED IN RABBIT (C15-1451-530)
Price: $977.14List Price: $1,085.71Immunogen thymocyte selection associated family member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA031096-100UL
Anti-THEMIS2 antibody produced in rabbit (C15-1452-976)
Price: $889.20List Price: $988.00Immunogen Protein THEMIS2 (Thymocyte-expressed molecule involved in selection protein 2)(Induced by contact to basement membrane 1 protein)(Protein ICB-1) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered -
HPA031097-100UL
Anti-THEMIS2 antibody produced in rabbit (C15-1452-977)
Price: $889.20List Price: $988.00Immunogen Protein THEMIS2 (Thymocyte-expressed molecule involved in selection protein 2)(Induced by contact to basement membrane 1 protein)(Protein ICB-1) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered -
HPA035877-100UL
Anti-THG1L antibody produced in rabbit (C15-1454-065)
Price: $928.29List Price: $1,031.43Immunogen tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA035878-100UL
Anti-THG1L antibody produced in rabbit (C15-1454-066)
Price: $928.29List Price: $1,031.43Immunogen tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA037585-100UL
Anti-THNSL1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen threonine synthase-like 1 (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA035395-100UL
Anti-THNSL2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen threonine synthase-like 2 ( S. cerevisiae ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a