Rabbit epithelium allergenic extract

Immunogen KIAA1609 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

TLE3 is known to function as a transcriptional coregulator of adipogenesis. It interacts with HESX1 and PROP1 to regulate transcriptional expression.

Transducin-like enhancer of split 3 (TLE3) belongs to the groucho family and comprises Q and&nbspWD40 domains. The TLE3 gene is mapped to human chromosome locus 15q23.

Immunogen transducin-like enhancer of split 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen Serine/threonine-protein kinase tousled-like 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen tolloid-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

TLN1 (talin 1) is a cytoskeletal protein expressed at cell-extracellular matrix. It is generally a high-molecular-weight molecule, widely distributed from molds to humans.

Immunogen toll like receptor 10 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Toll-like receptor 4 (TLR4) is a member of the pattern recognition receptors (PRRs) family. It is expressed on the cell surface of endothelial cells, cardiac myocytes, and central nervous system (CNS).

Immunogen Toll-like receptor 8 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to T-cell leukemia homeobox 3 Sequence APFEDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and