Rabbit epithelium allergenic extract

Immunogen Recombinant protein corresponding to T-cell leukemia homeobox 3 Sequence PPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen Recombinant protein corresponding to T-cell leukemia homeobox 3 Sequence SRLMLQLQHDAFQKSLNDSIQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Transmembrane 4 L6 family member 1 recombinant protein epitope signature tag (PrEST) Application Anti-TM4SF1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each

Immunogen transmembrane 4 L six family member 18 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen transmembrane 9 superfamily member 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Transmembrane 9 superfamily member 2 (TM9SF2) is found primarily in endosomes. It has a hydrophilic N-terminal domain and a hydrophobic C-terminal domain which contains nine membrane-spanning domains.

Immunogen transmembrane 9 superfamily member 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen transmembrane 9 superfamily protein member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen chromosome 4 open reading frame 43 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen translation machinery associated 16 homolog Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

TEMED1 (transmembrane emp24 domain-containing protein-1) belongs to TMED/p24 family of proteins. TEMED1 is widely expressed.

Immunogen transmembrane emp24-like trafficking protein 10 (yeast) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most