-
Add to Cart The item has been addedHPA070651-100ULAnti-ARSE antibody produced in rabbit (C15-1465-883)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to arylsulfatase E (chondrodysplasia punctata 1) Sequence HFYGMPFSLMGDCARWELSEKRVNLEQKLNFLF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA038386-100ULAnti-ARSI antibody produced in rabbit (C15-1455-216)
Price: $928.29List Price: $1,031.43Immunogen arylsulfatase family, member I recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA038398-100ULAnti-ARSI antibody produced in rabbit (C15-1455-226)
Price: $928.29List Price: $1,031.43Immunogen arylsulfatase family, member I Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA036481-100ULAnti-ARSJ antibody produced in rabbit (C15-1454-377)
Price: $928.29List Price: $1,031.43Immunogen arylsulfatase family, member J Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA036482-100ULAnti-ARSJ antibody produced in rabbit (C15-1454-378)
Price: $928.29List Price: $1,031.43Immunogen arylsulfatase family, member J recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA042384-100ULAnti-ARSK antibody produced in rabbit
Price: $977.14List Price: $1,085.71Immunogen arylsulfatase family, member K recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA035709-100ULAnti-ARV1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ARV1 homolog (S. cerevisiae) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA003299-100ULAnti-ASB8 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Ankyrin repeat and SOCS box protein 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA003014-100ULAnti-ASB9 antibody produced in rabbit (C15-1445-748)
Price: $879.43List Price: $977.14Immunogen Ankyrin repeat and SOCS box protein 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA003060-100ULAnti-ASB9 antibody produced in rabbit (C15-1445-770)
Price: $879.43List Price: $977.14Immunogen Ankyrin repeat and SOCS box protein 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA030502-100ULAnti-ASF1A antibody produced in rabbit (C15-1452-724)
Price: $879.43List Price: $977.14Immunogen anti-silencing function 1A histone chaperone Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA071495-100ULAnti-ASF1A antibody produced in rabbit (C15-1466-050)
Price: $928.29List Price: $1,031.43Immunogen anti-silencing function 1A histone chaperone Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
