-
Add to Cart The item has been addedHPA055904-100ULAnti-TMEM160 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen transmembrane protein 160 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA043365-100ULAnti-TMEM161A antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen transmembrane protein 161A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA038299-100ULAnti-TMEM165 antibody produced in rabbit (C15-1455-173)
Price: $928.29List Price: $1,031.43Immunogen transmembrane protein 165 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA062424-100ULAnti-TMEM165 antibody produced in rabbit (C15-1464-072)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to transmembrane protein 165 Sequence DKTFFIAAIMAMRYNRLTVL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA020389-100ULAnti-TMEM168 antibody produced in rabbit (C15-1449-587)
Price: $879.43List Price: $977.14The gene encoding transmembrane protein 168 (TMEM168) is localized on human chromosome 7. Immunogen Transmembrane protein 168 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA077143-100ULANTI-TMEM168 ANTIBODY PRODUCED IN RABBIT (C15-1466-993)
Price: $977.14List Price: $1,085.71Immunogen transmembrane protein 168 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA062462-100ULAnti-TMEM169 antibody produced in rabbit (C15-1464-086)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to transmembrane protein 169 Sequence VVQLSWSWEAWWQAARDMEKGFCGWLCSKLGLEDCSPYSIVELLESDNISSTLSNKDPIQEVETST Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the -
Add to Cart The item has been addedHPA062797-100ULAnti-TMEM169 antibody produced in rabbit (C15-1464-195)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to transmembrane protein 169 Sequence MEEPTAVEGQVQLPSPHQGSLRKAVAAALALDGESTMGHRKKKRKESRPESIIIYRSDNE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA070657-100ULAnti-TMEM169 antibody produced in rabbit (C15-1465-885)
Price: $928.29List Price: $1,031.43Immunogen transmembrane protein 169 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA074877-100ULANTI-TMEM169 ANTIBODY PRODUCED IN RABBIT (C15-1466-633)
Price: $977.14List Price: $1,085.71Immunogen transmembrane protein 169 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA055071-100ULAnti-TMEM170A antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen transmembrane protein 170A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA055134-100ULAnti-TMEM170B antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen transmembrane protein 170B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
