Rabbit epithelium allergenic extract

Immunogen transmembrane protein 247 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen UPF0458 protein C7orf42 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen transmembrane protein 249 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen family with sequence similarity 70, member A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen UPF0679 protein C14orf101 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

C9orf123 is a putative transmembrane protein, which is encoded by the gene localized to human chromosome 9p24. Immunogen Uncharacterized protein C9orf123 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Immunogen transmembrane protein 266 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to transmembrane protein 266 Sequence YVLPVKLEMEMVIQQYEKAKVIQDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAALQAPHVLSQPRSRFKVLE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen transmembrane protein 268 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

TMEM30A codes for a transmembrane protein that is present in the endoplasmic reticulum. Studies have reported that TMEM30A facilitates the import of bioactive and anticancer phospholipids into mammalian cells.

TMEM30A (transmembrane protein 30A) is a functional homolog of Saccharomyces cerevisiae Lem3p protein. It has the conserved sequence QNHRRYVKS and is a transmembrane protein.

Immunogen transmembrane protein 30B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are