-
Add to Cart The item has been addedAV46418-100ULAnti-TMPRSS11D antibody produced in rabbit (C15-1341-602)
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the N terminal region of human TMPRSS11D Application Anti-TMPRSS11D antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml. -
Add to Cart The item has been addedHPA052834-100ULAnti-TMPRSS11D antibody produced in rabbit (C15-1461-159)
Price: $928.29List Price: $1,031.43Immunogen transmembrane protease, serine 11D recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA077704-100ULANTI-TMPRSS11D ANTIBODY PRODUCED IN RABBIT (C15-1467-076)
Price: $977.14List Price: $1,085.71Immunogen transmembrane serine protease 11D Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA051062-100ULAnti-TMPRSS11E antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen transmembrane protease, serine 11E recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA026911-100ULAnti-TMPRSS11F antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Transmembrane protease, serine 11F recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA015611-100ULAnti-TMPRSS15 antibody produced in rabbit (C15-1448-389)
Price: $879.43List Price: $977.14Immunogen Enteropeptidase precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA034857-100ULANTI-TMPRSS15 ANTIBODY PRODUCED IN RABBIT (C15-1453-590)
Price: $977.14List Price: $1,085.71Immunogen transmembrane serine protease 15 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA040630-100ULAnti-TMPRSS7 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen transmembrane protease, serine 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA051483-100ULAnti-TMPRSS9 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen transmembrane protease, serine 9 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA003085-100ULAnti-TMX1 antibody produced in rabbit
Price: $977.14List Price: $1,085.71Immunogen Thioredoxin domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedHPA000399-100ULAnti-TMX4 antibody produced in rabbit (C15-1444-927)
Price: $879.43List Price: $977.14Immunogen Thioredoxin domain-containing protein 13 precursor recombinant protein epitope signature tag (PrEST) Sequence QLTALLAAWIAAVAATAGPEEAALPPEQSRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWEAFAKNGEILQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIF Application All -
Add to Cart The item has been addedHPA015752-100ULAnti-TMX4 antibody produced in rabbit (C15-1448-441)
Price: $879.43List Price: $977.14Immunogen Thioredoxin domain-containing protein 13 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and
