Rabbit epithelium allergenic extract

Immunogen T cell receptor associated transmembrane adaptor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen triadin recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

The human triadin (TRDN) gene is located on human chromosome 6. It has 41 exons, with an average of 58 bp per exon and spans around 420 kb.

Immunogen trehalase (brush-border membrane glycoprotein) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen trehalase (brush-border membrane glycoprotein) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen triggering receptor expressed on myeloid cells 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

TREML1 (Triggering receptor expressed on myeloid cells-like 1) is a platelet immunoreceptor membrane protein belonging to the TREM family. It consists of a single Ig superfamily V-type domain and a cytoplasmic tail with two immunoreceptor

Immunogen Trem-like transcript 1 protein precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen triggering receptor expressed on myeloid cells-like 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen thyrotropin-releasing hormone Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Synthetic peptide directed towards the middle region of human TRHR Application Anti-TRHR antibody produced in rabbit is suitable for western blotting at a concentration of 1 &#956g/ml. Biochem/physiol Actions Thyrotropin-releasing

Immunogen Recombinant protein corresponding to thyrotropin releasing hormone receptor Sequence ILFLNPIPSDPKENSKTWKNDSTHQNTNLNVNTSNRCFNSTVSSRKQVTK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the