-
HPA056290-100UL
Anti-UGT3A1 antibody produced in rabbit (C15-1462-298)
Price: $928.29List Price: $1,031.43Immunogen UDP glycosyltransferase 3 family, polypeptide A1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as -
HPA014405-100UL
Anti-UGT8 antibody produced in rabbit (C15-1448-131)
Price: $879.43List Price: $977.14The gene UGT8 (UDP glycosyltransferase 8) encodes a biosynthetic member of the UDP-glycosyltransferase family of proteins. It is abundantly expressed in the kidney and gastrointestinal tract. -
HPA065785-100UL
Anti-UGT8 antibody produced in rabbit (C15-1464-962)
Price: $928.29List Price: $1,031.43Immunogen UDP glycosyltransferase 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA071190-100UL
Anti-UHMK1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen U2AF homology motif (UHM) kinase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA049408-100UL
ANTI-UHRF1 ANTIBODY PRODUCED IN RABBIT (C15-1459-933)
Price: $928.29List Price: $1,031.43Immunogen ubiquitin-like with PHD and ring finger domains 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA055446-100UL
Anti-UHRF1 antibody produced in rabbit (C15-1462-018)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to ubiquitin like with PHD and ring finger domains 1 Sequence RARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDE Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA032099-100UL
Anti-UHRF1BP1 antibody produced in rabbit (C15-1453-382)
Price: $889.20List Price: $988.00Immunogen UHRF1 binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA032100-100UL
Anti-UHRF1BP1 antibody produced in rabbit (C15-1453-383)
Price: $889.20List Price: $988.00Immunogen UHRF1 binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA039671-100UL
Anti-UHRF1BP1L antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen UHRF1 binding protein 1-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA071005-100UL
Anti-ULBP1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen UL16 binding protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA063007-100UL
Anti-ULBP3 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen UL16 binding protein 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA063990-100UL
Anti-ULK1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen unc-51 like autophagy activating kinase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive