Rabbit epithelium allergenic extract

Immunogen unc-51-like kinase 3 (C. elegans) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Unc-51-like kinase 4 (ULK4) is a 1275 amino acid kinase expressed in the neurons. The gene encoding ULK4 is localized on human chromosome 3p22.

Immunogen uromodulin-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen uridine monophosphate synthetase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen uridine monophosphate synthetase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen unc-119 homolog ( C. elegans ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen unc-119 lipid binding chaperone B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization

Immunogen unc-45 homolog A (C. elegans) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Unc-45 myosin chaperone B (UNC45B) is a muscle-specific chaperone which is expressed in the heart and skeletal muscles. It has an amino terminus which contains three tetratricopeptide repeat (TPR) motifs, a central region and a carboxyl terminal

Immunogen unc-5 netrin receptor B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen unc-5 homolog C (C. elegans)-like recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to unc-79 homolog (C. elegans) Sequence SFALPEMSLDDHPDPGTEGEKPGELMPSSGAKTVLLKVPEDAENPTESEKPDTSAESDTEQNPERKVEEDGAEESEFKIQIVPRQRKQRKIAVSA Application All Prestige Antibodies Powered by Atlas Antibodies are