-
Add to Cart The item has been addedHPA006777-100ULAnti-USP2 antibody produced in rabbit (C15-1446-727)
Price: $879.43List Price: $977.14USP2 (Ubiquitin specific peptidase 2) is a 69kDa protein belonging to the de-ubiquitinating enzyme family. It is highly expressed in the kidney tissue and responsible for the regulation of cell growth and differentiation. -
Add to Cart The item has been addedHPA007222-100ULAnti-USP2 antibody produced in rabbit (C15-1446-834)
Price: $879.43List Price: $977.14USP2 (Ubiquitin specific peptidase 2) is a 69kDa protein belonging to the de-ubiquitinating enzyme family. It is highly expressed in the kidney tissue and responsible for the cell growth regulation and differentiation. -
Add to Cart The item has been addedHPA053275-100ULAnti-USP3 antibody produced in rabbit (C15-1461-283)
Price: $928.29List Price: $1,031.43Immunogen ubiquitin specific peptidase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA060513-100ULAnti-USP3 antibody produced in rabbit (C15-1463-556)
Price: $928.29List Price: $1,031.43Immunogen ubiquitin specific peptidase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA077975-100ULAnti-USP3 antibody produced in rabbit (C15-1467-119)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to ubiquitin specific peptidase 3 Sequence PFLDLSLDIPSQFRSKRSKNQENGPVCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedHPA016952-100ULAnti-USP30 antibody produced in rabbit
Price: $879.43List Price: $977.14USP30 (ubiquitin specific peptidase 30) is a deubiquitinating protein localized in the outer membrane of mitochondria. USP30 is encoded by the gene mapped to human chromosome 12q24. -
Add to Cart The item has been addedHPA044365-100ULAnti-USP32 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ubiquitin specific peptidase 32 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA005719-100ULAnti-USP33 antibody produced in rabbit
Price: $879.43List Price: $977.14Ubiquitin specific peptidase 33 (USP33) belongs to the ubiquitin-specific protease (USP) subclass. It is localized to the cytoplasm, including the endoplasmic reticulum. -
Add to Cart The item has been addedHPA036990-100ULAnti-USP38 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ubiquitin specific peptidase 38 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedAV38825-100ULAnti-USP39 antibody produced in rabbit (C15-1341-132)
Price: $898.29List Price: $998.10Immunogen Synthetic peptide directed towards the N terminal region of human USP39 Biochem/physiol Actions USP39 is a ubiquitin specific peptidase, a neuronal slicing factor expressed in the brain. It maintains embryonic pituitary homeostasis in -
Add to Cart The item has been addedHPA077350-100ULANTI-USP39 ANTIBODY PRODUCED IN RABBIT (C15-1467-021)
Price: $977.14List Price: $1,085.71Immunogen ubiquitin specific peptidase 39 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA018499-100ULAnti-USP4 antibody produced in rabbit
Price: $879.43List Price: $977.14The gene USP4 (ubiquitin carboxyl-terminal hydrolase-4) is mapped to human chromosome 3p21.3.
