-
Add to Cart The item has been addedHPA016992-100ULAnti-VASN antibody produced in rabbit (C15-1448-650)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to vasorin Sequence LDVSNLSLQALPGDLSGLFPRLRLLAAARNPFNCVCPLSWFGPWVRESHVTLASPEETRCHFPPKNAGRLLLELDYADFGCPATTTTATVPTTRPVVREPTALSSSLAPT Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA004726-100ULAnti-VCAN antibody produced in rabbit
Price: $879.43List Price: $977.14Versican (VCAN) encodes a large chondroitin sulfate proteoglycan named as versican. It is expressed in human fibroblasts. -
Add to Cart The item has been addedHPA002131-100ULAnti-VCL antibody produced in rabbit (C15-1445-540)
Price: $879.43List Price: $977.14Vinculin (VCL), a ubiquitously expressed actin-binding cytoskeletal protein, is involved with the cytoplasmic adhesion of cell-cell and cell-extracellular matrix. It is composed of an N-terminal globular head connected via a short polyproline-rich -
Add to Cart The item has been addedHPA063777-100ULAnti-VCL antibody produced in rabbit (C15-1464-483)
Price: $928.29List Price: $1,031.43Immunogen vinculin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
Add to Cart The item has been addedHPA044996-100ULAnti-VCY antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen variable charge, Y-linked Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA069116-100ULAnti-VEGFA antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen vascular endothelial growth factor A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA050955-100ULAnti-VENTX antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen VENT homeobox recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA026645-100ULAnti-VEPH1 antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Ventricular zone-expressed PH domain-containing protein homolog 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA017324-100ULAnti-VIP antibody produced in rabbit (C15-1448-738)
Price: $879.43List Price: $977.14VIP (vasoactive intestinal peptide) is a 28-amino acid peptide expressed in gastrointestinal tissues and neural tissues. It is originally isolated from porcine duodenum. -
Add to Cart The item has been addedHPA072701-100ULAnti-VIP antibody produced in rabbit (C15-1466-268)
Price: $928.29List Price: $1,031.43Immunogen vasoactive intestinal peptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA003589-100ULAnti-VIPAS39 antibody produced in rabbit (C15-1446-017)
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C14orf133 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA003593-100ULAnti-VIPAS39 antibody produced in rabbit (C15-1446-020)
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C14orf133 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
