-
HPA047844-100UL
Anti-WASHC2A antibody produced in rabbit (C15-1459-357)
Price: $928.29List Price: $1,031.43Immunogen WASH complex subunit 2A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA060975-100UL
Anti-WASHC2A antibody produced in rabbit (C15-1463-669)
Price: $928.29List Price: $1,031.43Immunogen WASH complex subunit 2A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA061022-100UL
Anti-WASHC2A antibody produced in rabbit (C15-1463-685)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to WASH complex subunit 2A Sequence GIQAKTTKPKSRSAQAAPEPRFEHKVSNIFDDPLNAFGGQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA038338-100UL
Anti-WASHC3 antibody produced in rabbit (C15-1455-196)
Price: $928.29List Price: $1,031.43Immunogen WASH complex subunit 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA038339-100UL
Anti-WASHC3 antibody produced in rabbit (C15-1455-197)
Price: $928.29List Price: $1,031.43Immunogen WASH complex subunit 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA045666-100UL
Anti-WASHC4 antibody produced in rabbit (C15-1458-601)
Price: $928.29List Price: $1,031.43Immunogen WASH complex subunit 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA046737-100UL
Anti-WASHC4 antibody produced in rabbit (C15-1458-970)
Price: $928.29List Price: $1,031.43Immunogen WASH complex subunit 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA064649-100UL
Anti-WASHC5 antibody produced in rabbit (C15-1464-684)
Price: $928.29List Price: $1,031.43Immunogen WASH complex subunit 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA070916-100UL
Anti-WASHC5 antibody produced in rabbit (C15-1465-927)
Price: $928.29List Price: $1,031.43Immunogen WASH complex subunit 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
HPA005750-100UL
Anti-WASL antibody produced in rabbit
Price: $879.43List Price: $977.14Immunogen Neural Wiskott-Aldrich syndrome protein recombinant protein epitope signature tag (PrEST) Application Anti-WASL antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each -
HPA056607-100UL
Anti-WDR38 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 38 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA040427-100UL
Anti-WDR82 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen WD repeat domain 82 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the