Rabbit epithelium allergenic extract

Immunogen WEE1 homolog 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen WD repeat domain phosphoinositide-interacting protein 1 recombinant protein epitope signature tag (PrEST) Application Anti-WIPI1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA)

WIPI2 (WD repeat domain, phosphoinositide interacting 2) is a WD-repeat PtdIns(3)P (phosphatidylinositol 3-phosphate) effector protein expressed in the endoplasmic reticulum. It is expressed in different cell lines.

WD repeat domain, phosphoinositide-interacting 2 belongs to the WIPI protein family. It is localized on the autophagy membrane and plasma membrane.

Immunogen WNK lysine deficient protein kinase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen WNK lysine deficient protein kinase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen WNK lysine deficient protein kinase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen WNK lysine deficient protein kinase 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Synthetic peptide directed towards the C terminal region of human WNT16 Biochem/physiol Actions WNT proteins are secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes,

Wnt family member 16 (WNT16) exists in two isoforms-WNT16A and WNT16B. The gene encoding this protein is localized on human chromosome 7q31.

Immunogen Synthetic peptide directed towards the N terminal region of human WNT2B Biochem/physiol Actions WNT2B is a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members

Immunogen Recombinant protein corresponding to Wnt family member 2B Sequence TCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLVYF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein