-
Add to Cart The item has been addedAV46095-100ULAnti-ATIC (AB2) antibody produced in rabbit
Price: $759.43List Price: $843.81Immunogen Synthetic peptide directed towards the N terminal region of human ATIC Application Anti-ATIC (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml. -
Add to Cart The item has been addedHPA029108-100ULAnti-ATL2 antibody produced in rabbit (C15-1452-136)
Price: $879.43List Price: $977.14Immunogen atlastin GTPase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA075302-100ULAnti-ATL2 antibody produced in rabbit (C15-1466-711)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to atlastin GTPase 2 Sequence RTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDDHNFELDEEALEQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA065702-100ULAnti-ATL3 antibody produced in rabbit (C15-1464-939)
Price: $928.29List Price: $1,031.43Immunogen atlastin GTPase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA076616-100ULAnti-ATL3 antibody produced in rabbit (C15-1466-917)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to atlastin GTPase 3 Sequence NLAAAASAKDIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSFRYQQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
Add to Cart The item has been addedHPA031619-100ULAnti-ATN1 antibody produced in rabbit
Price: $977.14List Price: $1,085.71Immunogen atrophin 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA049400-100ULANTI-ATOH1 ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen atonal bHLH transcription factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedAV39728-100ULAnti-ATOH8 antibody produced in rabbit (C15-1341-179)
Price: $759.43List Price: $843.81Atonal homolog 8 (Drosophila) (ATOH8) is a basic helix-loop-helix (bHLH) transcription factor involved in the vertebrae tissue-specific differentiation of the nervous system, kidneys, pancreas, retina and muscle during embryogenesis. Specificity -
Add to Cart The item has been addedHPA028406-100ULAnti-ATOH8 antibody produced in rabbit (C15-1451-814)
Price: $879.43List Price: $977.14Immunogen atonal bHLH transcription factor 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA035630-100ULAnti-ATP9A antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ATPase, class II, type 9A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA054320-100ULAnti-ATR antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ATR serine/threonine kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA047590-100ULAnti-ATRIP antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen ATR interacting protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
