-
HPA076632-100UL
ANTI-CAB39L ANTIBODY PRODUCED IN RABBIT (C15-1466-919)
Price: $977.14List Price: $1,085.71Immunogen calcium binding protein 39 like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA043296-100UL
Anti-CABIN1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen calcineurin binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA073649-100UL
Anti-CABLES1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to Cdk5 and Abl enzyme substrate 1 Sequence SRGRLNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQRSRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKN Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA052138-100UL
Anti-CABLES2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Cdk5 and Abl enzyme substrate 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA068138-100UL
ANTI-CACNA1A ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen calcium voltage-gated channel subunit alpha1 A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA068379-100UL
Anti-CACNA1F antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to calcium voltage-gated channel subunit alpha1 F Sequence SCEDLPIPGTYHRGRNSGPNRAQGSWATPPQRGRLLYAPLLLVEEGAAGEGYLGRSSGPLRTFTCLHVPGTHSDPSH Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA048892-100UL
Anti-CACNA1S antibody produced in rabbit (C15-1459-740)
Price: $928.29List Price: $1,031.43Immunogen calcium channel, voltage-dependent, L type, alpha 1S subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA056815-100UL
Anti-CACNA1S antibody produced in rabbit (C15-1462-456)
Price: $928.29List Price: $1,031.43Immunogen calcium channel, voltage-dependent, L type, alpha 1S subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA041351-100UL
Anti-CACNG8 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen calcium channel, voltage-dependent, gamma subunit 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA042504-100UL
Anti-CACTIN antibody produced in rabbit (C15-1457-240)
Price: $928.29List Price: $1,031.43Immunogen chromosome 19 open reading frame 29 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA042548-100UL
Anti-CACTIN antibody produced in rabbit (C15-1457-258)
Price: $928.29List Price: $1,031.43Immunogen chromosome 19 open reading frame 29 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA044999-100UL
Anti-CALM1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen calmodulin 1 (phosphorylase kinase, delta) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive