-
Add to Cart The item has been addedHPA059502-100ULAnti-CARD9 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen caspase recruitment domain family, member 9 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA044404-100ULAnti-CASD1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen CAS1 domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA001302-100ULAnti-CASP8 antibody produced in rabbit (C15-1445-233)
Price: $879.43List Price: $977.14Immunogen Caspase-8 precursor recombinant protein epitope signature tag (PrEST) Sequence GIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDILTILTEVNYEVSNKDDKKNMGKQMPQP Application -
Add to Cart The item has been addedHPA005688-100ULAnti-CASP8 antibody produced in rabbit (C15-1446-431)
Price: $879.43List Price: $977.14Caspase 8 (CASP8) is a cysteine protease, belonging to the cysteine-aspartic acid protease (caspase) family. Immunogen Caspase-8 precursor recombinant protein epitope signature tag (PrEST) Sequence -
Add to Cart The item has been addedHPA006191-100ULAnti-CASP8 antibody produced in rabbit (C15-1446-585)
Price: $879.43List Price: $977.14Immunogen caspase 8, apoptosis-related cysteine peptidase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAV50555-100ULAnti-CASP8AP2 antibody produced in rabbit (C15-1341-795)
Price: $898.29List Price: $998.10CASP8AP2 codes for caspase 8 associated protein 2 and it may be implicated in apoptosis. This gene has been studied as a prognostic biomarker in pediatric acute lymphoblastic leukemia. -
Add to Cart The item has been addedHPA053573-100ULAnti-CASP8AP2 antibody produced in rabbit (C15-1461-380)
Price: $928.29List Price: $1,031.43Immunogen caspase 8 associated protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA001473-100ULAnti-CASP9 antibody produced in rabbit (C15-1445-297)
Price: $879.43List Price: $977.14CASP9 (Caspase-9) gene encodes a protein belonging to the cysteine-aspartic acid protease (caspase) family. It consists of two domains. -
Add to Cart The item has been addedHPA046488-100ULAnti-CASP9 antibody produced in rabbit (C15-1458-858)
Price: $928.29List Price: $1,031.43Immunogen caspase 9, apoptosis-related cysteine peptidase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA039686-100ULAnti-CASR antibody produced in rabbit (C15-1455-847)
Price: $928.29List Price: $1,031.43Immunogen calcium-sensing receptor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
Add to Cart The item has been addedHPA050335-100ULAnti-CASR antibody produced in rabbit (C15-1460-261)
Price: $928.29List Price: $1,031.43Immunogen calcium-sensing receptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA051282-100ULAnti-CAT antibody produced in rabbit (C15-1460-601)
Price: $928.29List Price: $1,031.43Immunogen catalase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human
