Rabbit epithelium allergenic extract

Cyclin Y (CCNY) is encoded by the gene mapped to human chromosome 10p11.21.

Immunogen C-C motif chemokine receptor 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

CCR4 (carbon catabolite repressor protein 4 homolog), a C-C type chemokine receptor. CCR4 is precisely expressed on surfaces of cells such as T helper type 2 cells, regulatory T cells, interluekin-17–producing T-helper cells (Th17), and

The gene CCR6 (C-C motif chemokine receptor 6) encodes a chemokine receptor that is mainly expressed in B cells and memory T cells. It is also found to be expressed in dendritic cells, spleen, thymus, small intestine, and peripheral blood

Immunogen chemokine (C-C motif) receptor 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen chemokine (C-C motif) receptor 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Synthetic peptide directed towards the middle region of human CCR8 Application Anti-CCR8 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 &#956g/ml.

Immunogen Recombinant protein corresponding to C-C motif chemokine receptor 8 Sequence MDYTLDLSVTTVTDYYYPDIFSSPCDGELIQTNGKLLL Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen copper chaperone for superoxide dismutase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen copper chaperone for superoxide dismutase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen chaperonin containing TCP1, subunit 4 (delta) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

The gene T-complex protein 1 subunit &#952 (CCT8) is mapped to human chromosome 21q22.11.