Rabbit epithelium allergenic extract

Immunogen calcium homeostasis endoplasmic reticulum protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and

Immunogen chitinase, acidic Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

CHIT1 (chitinase 1) gene is localized to human chromosome 1. This protein is highly expressed in cells of innate immune system, especially on activated macrophages.

Immunogen chitinase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Choline kinase alpha recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Western Blotting (1 paper)

The gene CHM (choroideremia) is mapped to human chromosome Xq21.2.

Immunogen Recombinant protein corresponding to choroideremia-like (Rab escort protein 2). Sequence VEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITYSQIVKEGRRFNIDLVS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen choroideremia-like (Rab escort protein 2) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to choroideremia-like (Rab escort protein 2). Sequence LEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Carbohydrate sulfotransferase 4 (CHST4) is an N-acetylglucosamine 6-O-sulfotransferase belonging to the novel family of carbohydrate sulfotransferases. It is highly expressed on high endothelial venules, where it is hypothesized to play an

Immunogen Carbohydrate sulfotransferase 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein