-
Add to Cart The item has been addedHPA056246-100ULAnti-CLIP4 antibody produced in rabbit (C15-1462-287)
Price: $928.29List Price: $1,031.43Immunogen CAP-GLY domain containing linker protein family, member 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA036458-100ULAnti-CLTB antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen clathrin, light chain B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA031505-100ULAnti-CLUH antibody produced in rabbit (C15-1453-148)
Price: $889.20List Price: $988.00Immunogen clustered mitochondria (cluA/CLU1) homolog Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA044346-100ULAnti-CLUH antibody produced in rabbit (C15-1458-112)
Price: $928.29List Price: $1,031.43Immunogen KIAA0664 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA039905-100ULAnti-CMAS antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen cytidine monophosphate N-acetylneuraminic acid synthetase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA027885-100ULAnti-COIL antibody produced in rabbit (C15-1451-644)
Price: $879.43List Price: $977.14Immunogen coilin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
Add to Cart The item has been addedHPA057480-100ULANTI-COIL ANTIBODY PRODUCED IN RABBIT (C15-1462-668)
Price: $977.14List Price: $1,085.71Immunogen coilin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
Add to Cart The item has been addedHPA068537-100ULAnti-COIL antibody produced in rabbit (C15-1465-498)
Price: $928.29List Price: $1,031.43Immunogen coilin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
Add to Cart The item has been addedHPA053107-100ULAnti-COL8A1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Collagen type VIII α 1 chain (COL8A1) is one of the two α chains of type VIII collagen, which is involved in angiogenesis and artery remodeling. It is the major component of the Descemet′s membrane of the cornea. -
Add to Cart The item has been addedHPA049788-100ULAnti-COL8A2 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen collagen, type VIII, alpha 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA074749-100ULAnti-COL9A1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to collagen type IX alpha 1 chain Sequence PIKPRGPIDIDGFAVLGKLADNPQVSVPFELQWMLIHCDPLRPRRETCHELPARITPSQTTDERGPPGEQGPP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedHPA056316-100ULAnti-COL9A2 antibody produced in rabbit (C15-1462-308)
Price: $928.29List Price: $1,031.43Immunogen collagen, type IX, alpha 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
