-
HPA075286-100UL
Anti-COL9A2 antibody produced in rabbit (C15-1466-708)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to collagen type IX alpha 2 chain Sequence RGVPGQPGRQGVEGRDATDQHIVDVALKML Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
HPA040125-100UL
Anti-COL9A3 antibody produced in rabbit (C15-1456-073)
Price: $928.29List Price: $1,031.43Immunogen collagen, type IX, alpha 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA058323-100UL
Anti-COL9A3 antibody produced in rabbit (C15-1462-910)
Price: $928.29List Price: $1,031.43Immunogen collagen, type IX, alpha 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA034633-100UL
Anti-COMMD1 antibody produced in rabbit (C15-1453-487)
Price: $889.20List Price: $988.00Immunogen copper metabolism (Murr1) domain containing 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA049223-100UL
Anti-COMMD1 antibody produced in rabbit (C15-1459-866)
Price: $928.29List Price: $1,031.43Immunogen copper metabolism (Murr1) domain containing 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA035887-100UL
Anti-COMMD8 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen COMM domain containing 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported -
C6870-200UL
Anti-COMT antibody produced in rabbit (C15-1346-735)
Price: $956.57List Price: $1,062.86Catechol- O -methyltransferase (COMT) is encoded by the gene mapped to human chromosome 22q11.21. -
HPA001169-100UL
Anti-COMT antibody produced in rabbit (C15-1445-183)
Price: $879.43List Price: $977.14Immunogen Catechol O-methyltransferase recombinant protein epitope signature tag (PrEST) Application Anti-COMT antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is -
HPA052552-100UL
Anti-COPRS antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen chromosome 17 open reading frame 79 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA016867-100UL
Anti-COPS2 antibody produced in rabbit (C15-1448-621)
Price: $879.43List Price: $977.14Immunogen COP9 signalosome complex subunit 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA018271-100UL
Anti-COPS2 antibody produced in rabbit (C15-1448-980)
Price: $879.43List Price: $977.14The gene COP9 signalosome complex subunit 2 (COPS2) is mapped to human chromosome 15q21.2. -
HPA061071-100UL
Anti-COPS2 antibody produced in rabbit (C15-1463-693)
Price: $928.29List Price: $1,031.43Immunogen COP9 signalosome subunit 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the