Rabbit epithelium allergenic extract

Immunogen Uncharacterized protein C7orf58 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen copine VIII recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen coproporphyrinogen oxidase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen cysteine-rich secretory protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen crystallin, alpha A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to crystallin alpha A Sequence PSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Crystallin, &#945 B (CRYAB) is a molecular chaperone that holds protein in soluble aggregates. It functions as a tumor suppressor by interacting with adherens junction to inhibit the progression of nasopharyngeal carcinoma.

Immunogen crystallin, alpha B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

The gene CRYM (&#956-crystallin) is mapped to human chromosome 16p. CRYM is also referred as THBP (NADP-regulated thyroid-hormone-binding protein).

Immunogen crystallin, mu Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

CXorf61 or KKLC1 is a cancer/testis antigen that interacts with tumor-specific cytotoxic T lymphocytes in lung cancer cells. Thus, CXorf61 may be used as an immunological target for cancer therapy .

Immunogen CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,