-
HPA065779-100UL
Anti-DAXX antibody produced in rabbit (C15-1464-961)
Price: $928.29List Price: $1,031.43Immunogen death-domain associated protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA038541-100UL
Anti-DDIAS antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen DNA damage-induced apoptosis suppressor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA060952-100UL
ANTI-DDN ANTIBODY PRODUCED IN RABBIT
Price: $977.14List Price: $1,085.71Immunogen dendrin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human -
HPA023160-100UL
Anti-DECR1 antibody produced in rabbit (C15-1450-283)
Price: $879.43List Price: $977.14DECR1 (2,4-dienoyl-CoA reductase 1, mitochondrial) is a member of the short-chain dehydrogenase/reductase (SDR) superfamily. The gene is mapped to human chromosome 8q21. -
HPA023162-100UL
Anti-DECR1 antibody produced in rabbit (C15-1450-285)
Price: $879.43List Price: $977.14DECR1 (2,4-dienoyl-CoA reductase 1, mitochondrial) is a member of the short-chain dehydrogenase/reductase (SDR) superfamily. The gene is mapped to human chromosome 8q21. -
HPA023238-100UL
Anti-DECR1 antibody produced in rabbit (C15-1450-305)
Price: $879.43List Price: $977.14DECR1 (2,4-dienoyl-CoA reductase 1, mitochondrial) is a member of the short-chain dehydrogenase/reductase (SDR) superfamily. The gene is mapped to human chromosome 8q21. -
HPA030681-100UL
Anti-DEDD antibody produced in rabbit (C15-1452-792)
Price: $879.43List Price: $977.14Immunogen Recombinant protein corresponding to death effector domain containing. Sequence RGRATLGSQRKRRKSVTPDPKEKQTCDIRLRVRAEYCQHETALQGNVFSNKQDPLERQFERFNQANTILKSRDLGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVFITDSLKQAVGHEAIKLLVNV Application All Prestige -
HPA073628-100UL
Anti-DEDD antibody produced in rabbit (C15-1466-410)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to death effector domain containing Sequence LALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEETSIRYVTPRALSD Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
HPA041745-100UL
Anti-DEF8 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen differentially expressed in FDCP 8 homolog (mouse) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA076422-100UL
Anti-DEGS1 antibody produced in rabbit
Price: $928.29List Price: $1,031.43Immunogen delta(4)-desaturase, sphingolipid 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA054505-100UL
Anti-DEK antibody produced in rabbit (C15-1461-701)
Price: $928.29List Price: $1,031.43Immunogen DEK proto-oncogene Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA057799-100UL
Anti-DEK antibody produced in rabbit (C15-1462-758)
Price: $928.29List Price: $1,031.43Immunogen DEK proto-oncogene Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.