Rabbit epithelium allergenic extract

Immunogen docking protein 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen Synthetic peptide directed towards the middle region of human DONSON Biochem/physiol Actions This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.

Downstream neighbor of SON (DONSON) is encoded by the gene mapped to human chromosome 21. Immunogen downstream neighbor of SON recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen dopey family member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Immunogen dopey family member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

Doublecortin gene is mapped to human chromosome Xq23. It comprises two homologous doublecortin (DC) domains, one each in the N-terminal and C-terminal region.

The gene DPCR1 (diffuse panbronchiolitis critical region 1), located in the major histocompatibility complex class I, encodes a 235-amino acid protein that shares homology with the mucin-like domain of sperm multiple-domain transmembrane protein

Immunogen dipeptidase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen dipeptidase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen DPH3, KTI11 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen DPH5 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to diphthamide biosynthesis 5. Sequence VLRATKLGIPYRVIHNASIMNAVGCCGLQLYKFGETVSIVFWTDTWRPESFFDKVKKNRQNGMHTLCLLDIKVKEQSLENLIKGRKIYEPPRYMS Application All Prestige Antibodies Powered by Atlas Antibodies are