Rabbit epithelium allergenic extract

Immunogen ADAMTS-like 3 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen ADAMTS-like 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen ADAMTS-like protein 4 precursor recombinant protein epitope signature tag (PrEST) Application Anti-ADAMTSL4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each

Immunogen ADAMTS-like 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

ADCY10 (adenylate cyclase 10) is the soluble member of ten homologous adenylyl cyclases (ACs). The rest of the members are transmembrane proteins.

Adenylate cyclase type 10 (ADCY10) belongs to the cyclase class III family. It is present in the cytoplasm, mitochondria and nucleus.

Immunogen Adenylate cyclase type 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Recombinant protein corresponding to ADCYAP receptor type I Sequence KKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRSFNPDQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen adenylate cyclase activating polypeptide 1 (pituitary) receptor type I recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen adducin 3 (gamma) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

ADNP (activity-dependent neuroprotector homeobox) was initially identified as a vasoactive intestinal peptide (VIP) responsive gene in P19 carcinoma cells of mouse. This gene is localized to human chromosome 20q13.

Immunogen adenosine A1 receptor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the